Scaffold Ga0228550_104053

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0228550_104053

Scaffold Ga0228550_104053

Overview

Basic Information
Taxon OID	3300031584 Open in IMG/M
Scaffold ID	Ga0228550_104053 Open in IMG/M
Source Dataset Name	Metatranscriptome of Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States ? P5_L6_32mM_2 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1053
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Washington
Coordinates	Lat. (^o)	47.6519	Long. (^o)	-122.3113	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009117	Metagenome / Metatranscriptome	322	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228550_1040531	F009117	N/A	FTCTQGSDIVGDDRVGTEFKCRLSVPQAKAAFVNAQKETGGSVEDVSLDFDELLECIARCGVDKYRAVEQIKTGEKVAAMIANILGDLNEEQVITAATYITAERFSPGTSPPKGVAAENHKEWLTTWELLQLSTLPGFPLWEKEVYDLLALHLVELQSIFKAYASSSLQGSATDMDMEEFHDFVIEAGLITDLYGFDAMSGQFTKANAGSNDTVLELHEFLTMLVRISFFRANPQYGMRKGKDQKNADKFDEVPLPGCLSDMLTKLVLPNARRETHAQEFLEKIWPMSEVSSALDAQKEAIATFYEMVSAGRPFLELSQWFDALAGKLLFSDVTIDGYVVRLTQPQARAAF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.