NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265313_10190854

Scaffold Ga0265313_10190854


Overview

Basic Information
Taxon OID3300031595 Open in IMG/M
Scaffold IDGa0265313_10190854 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)856
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location
Location NameUSA: Seattle, Washington
CoordinatesLat. (o)47.6516Long. (o)-122.3045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000825Metagenome / Metatranscriptome874Y
F015937Metagenome / Metatranscriptome251Y

Sequences

Protein IDFamilyRBSSequence
Ga0265313_101908541F000825GGAGGMRTTFLLASTLVLAVTAAPAEAAWKSYVSHKLGFSFEAPGEVKSQMGTFRGQVAGPRETMVFRSVDDNIEYKVTVMSFQQAQGDAATILGEREYMFANDKKVLMDTFGRVEPGKEAIYGRKITIDLPDNKGRETAAFYFTKGNMYVLEATVLPANGDYATP
Ga0265313_101908542F015937N/ARNVANQSASILGEAEYIFQDNKKLLMDAFGRVDGKYGRKLTIDLPNKGGRTTAAFWFVNGRIVTLQATVLPANGDFDSPEMARFVDSITFYTVRAADDAIEVPVPK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.