NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307989_1009313

Scaffold Ga0307989_1009313


Overview

Basic Information
Taxon OID3300031603 Open in IMG/M
Scaffold IDGa0307989_1009313 Open in IMG/M
Source Dataset NameMarine microbial communities from Ellis Fjord, Antarctic Ocean - #185
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2995
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5958Long. (o)78.1913Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001334Metagenome / Metatranscriptome720Y
F068119Metagenome125N

Sequences

Protein IDFamilyRBSSequence
Ga0307989_10093134F001334N/AMKMMKFKEYLQTYADDSIEQVMDGEWIQKSRATWKATDNNDNTIEIHNDGHDPELNGESWTVHNNSFAPKAFAHFCKEFIQNVKPSEITHGRTRIYIKT
Ga0307989_10093135F068119GGAMAEHESILKLNTDIQTLKVKDEYRTKELDALMRKLDASTSKLNDLSENIGKLLVAQDANKMTDNEFREEMKILHSRIGDLQDKMNTVIDKTETRMNSDISMIYTKLESLERWRWITIGAATLVAWLLTNVIPKMLP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.