Scaffold Ga0302119_10211959

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0302119_10211959

Scaffold Ga0302119_10211959

Overview

Basic Information
Taxon OID	3300031606 Open in IMG/M
Scaffold ID	Ga0302119_10211959 Open in IMG/M
Source Dataset Name	Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	747
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location Name	Canada: Western Arctic Ocean
Coordinates	Lat. (^o)	70.5467	Long. (^o)	-122.9077	Alt. (m)		Depth (m)	450
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016284	Metagenome / Metatranscriptome	248	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302119_102119592	F016284	AGGA	MTSKKLKDFRKELLDKYSGKLTGYEHLDDGTGDYAKNVPEDSEKESEETSEKT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.