Basic Information | |
---|---|
Taxon OID | 3300031625 Open in IMG/M |
Scaffold ID | Ga0302135_10377289 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 552 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 80.9595 | Long. (o) | -132.1842 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046473 | Metagenome / Metatranscriptome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0302135_103772892 | F046473 | AGGAG | VSAGSGTTTTRSYMPGLFEALGNMPKREPKKFFVIVQDKEYEVSLEKKLWSQQHGEENLVFKDGEIVVKPAPLPKSRYRTLAKSEKGYFFEDD |
⦗Top⦘ |