NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302125_10047398

Scaffold Ga0302125_10047398


Overview

Basic Information
Taxon OID3300031638 Open in IMG/M
Scaffold IDGa0302125_10047398 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB4_surface
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1472
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)75.0007Long. (o)-150.0027Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001656Metagenome / Metatranscriptome656Y
F030157Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0302125_100473981F030157N/AAVDFITVDLLTTGAAEVTHPLAAANTAGLHLIREAIQHQGVNILGNGVQSAAFEHTFMVRRDSLDTISSTTTAAAIQAAIQALNANSKITQTISSATAADRDMGKLTAMA
Ga0302125_100473983F001656AGGAGMAYSTSLSAGGHSGDNVGRQAFNGKGLTFIECVFDVDITATATTPEAHDSAFDKVTNVINKNGTLLASSYRLAGKATDDDAAEAAAINADDSIDSYQFIVEGTPGQYNKADSAGDTNIDVTATVIADAEADIETDILAVLDIGDSAGNIQVKVRTLLPEGVSSAGDDAIHGMFDQRGDA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.