Scaffold Ga0302133_10075883

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0302133_10075883

Scaffold Ga0302133_10075883

Overview

Basic Information
Taxon OID	3300031646 Open in IMG/M
Scaffold ID	Ga0302133_10075883 Open in IMG/M
Source Dataset Name	Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1770
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location Name	Canada: Western Arctic Ocean
Coordinates	Lat. (^o)	77.9995	Long. (^o)	-150.0065	Alt. (m)		Depth (m)	200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061276	Metagenome	132	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0302133_100758833	F061276	AGGAG	MTKYMTRKVTKFAFVMPVYDYDITPHKDGVQDVMIPCEDRHMVGYNVYGWNYKKQSWKGIGIGDYYDEAKEIADTYDKKMVKKLGVYCDDMGDKKSYDER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.