NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308018_10152990

Scaffold Ga0308018_10152990


Overview

Basic Information
Taxon OID3300031655 Open in IMG/M
Scaffold IDGa0308018_10152990 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #282
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)792
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5596Long. (o)77.8957Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024225Metagenome207Y
F071255Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0308018_101529901F071255AGCAGMTDELKDFDDMKAQLKGLNSEEFSSIKGSINELSSKMDLTQKEKDGMFGVSEFVEHLNTCENDNCDIHKTQNTLNNNNYMKGFLLGAK
Ga0308018_101529902F024225N/AKSILTYIYDHYLFNDYKKIMEQDKWQINVRTLADFKWNFYDKEIKNLSKKMPHGVTGDNVIECYVTDENNRMYYLQNMMVICHELSHMILKIYYPQIRGTLTYDDTWGKAGDERNFFSTEIHNRVYEGKTRKLTTWHNGSAFFFYGVDIDDLTNQRNNNNGF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.