NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307375_10001501

Scaffold Ga0307375_10001501


Overview

Basic Information
Taxon OID3300031669 Open in IMG/M
Scaffold IDGa0307375_10001501 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - TR-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25419
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (77.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006130Metagenome380Y
F063259Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0307375_1000150118F006130AGGAMIPPKKAAPRTKRRVVSPAEKRTQLRLTVDSRFTLSHFTQLFAVLKI
Ga0307375_100015018F063259AGGAGGMHHITHSSLAVFSAICLLYALVVLAILQFCKVAKLKPNPPNSSTVRVELTISAPTPAGADPCKSEGTCVTTTFVFVDELARTVTDFLAGYNAPSRSDLLCFLQQTRGPIAGLFITRQDNNHVRNLTLLGEDAEKVSSYLTHCFNCQLASGTDEFHSESVSFTA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.