NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307375_10533644

Scaffold Ga0307375_10533644


Overview

Basic Information
Taxon OID3300031669 Open in IMG/M
Scaffold IDGa0307375_10533644 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - TR-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)702
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F002241Metagenome / Metatranscriptome579Y

Sequences

Protein IDFamilyRBSSequence
Ga0307375_105336441F002241AGGMSKPHSIRYIKQLMEWGFDKEFIARDAGINVESLMTRLRRAEERERNGNQRTESGTSSSQPDS
Ga0307375_105336442F000545N/AMDENRFRWALDIPKMIKDAHPFPCSNCKLVTPHIEIKRFSTEDVAEAPEEVWLVECQRCFLQRIIYPSDRVTSKEDDILRCEQCGGWKMKSGKCRVCRLAAGFEKISVKYWTGNSTMERPYDEQAPLY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.