NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318561_10098323

Scaffold Ga0318561_10098323


Overview

Basic Information
Taxon OID3300031679 Open in IMG/M
Scaffold IDGa0318561_10098323 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1535
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000823Metagenome / Metatranscriptome875Y
F030161Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0318561_100983232F000823GAGMIRGEVSMRLNVRLNVRRAATAILLGAALMGTSMGTSPATAAWHGYISHPLGFAFAAPGELKIEKGTYRGAVAGERATLVYRFLDDNIEYKAVVIDMADKANDSASLLGEAEYLFQDNKKLLMDSFGRVDRQYGRKLTIDLPNNGGRSSAAFYFINGRIISLQATVLPQNGDYDTAQMARFVDSLTFFTVRAADDAIELPPPPK
Ga0318561_100983233F030161GGAGGMRTLMSATLAAAALTLAVVPAQAAWKSYINRELGFSFRAPGEVKADIGTFRGAVAGPRQTIIYKSVDNNIEYKVTVMSFLQAQAEGASILGEREYMFQEGKKVLLDTFGRVEPGKDAVYGRKIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.