NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318561_10117973

Scaffold Ga0318561_10117973


Overview

Basic Information
Taxon OID3300031679 Open in IMG/M
Scaffold IDGa0318561_10117973 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1408
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000037Metagenome / Metatranscriptome4230Y
F006088Metagenome / Metatranscriptome382Y
F006226Metagenome / Metatranscriptome378Y

Sequences

Protein IDFamilyRBSSequence
Ga0318561_101179731F000037AGGMESDYLILRRASAFRPFGEWNDDDYDVLCNGVVVGRIMQAAAVPVGMSWMWTLAFGHQKDRTPTHGYAATREAAMTAFAKSWRRE
Ga0318561_101179732F006088AGGAMSSERNTCLQKADDAKQCAAQATEPFMKSAYEKVAEHWTLLARLESLIGNEKTNEDA
Ga0318561_101179733F006226GGGGGMNTAVACRLALGDRVLWIGKDDYQPSGPGTITRITAHQVEVLWEDETARRYRRTQLHNLRHRKLVCELHEARCA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.