Basic Information | |
---|---|
Taxon OID | 3300031694 Open in IMG/M |
Scaffold ID | Ga0308015_10341068 Open in IMG/M |
Source Dataset Name | Marine microbial communities from water near the shore, Antarctic Ocean - #231 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 604 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean | |||||||
Coordinates | Lat. (o) | -68.5596 | Long. (o) | 77.8957 | Alt. (m) | Depth (m) | 37 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084738 | Metagenome / Metatranscriptome | 112 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308015_103410683 | F084738 | N/A | VSTYTFADDVTITATADNITTPSFIIGDMNSSNSTIHTGVTAPDGWQGGKHTYDGSAWGNVAGWVDPKVAEIAALQAQIDALNA |
⦗Top⦘ |