Scaffold Ga0307995_1039341

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307995_1039341

Scaffold Ga0307995_1039341

Overview

Basic Information
Taxon OID	3300031696 Open in IMG/M
Scaffold ID	Ga0307995_1039341 Open in IMG/M
Source Dataset Name	Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2033
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-68.5958	Long. (^o)	78.1913	Alt. (m)		Depth (m)	18
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010724	Metagenome / Metatranscriptome	300	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307995_10393413	F010724	N/A	MATRTTENTNTLEEFRLNFNGLVTDIGDVSSLGGTAGDQLDTSATSIVGAINEIFAGFKLQSQIAGDDTYYLQSSNAETLILQGGSGVHTGSETTNIVTDITADDTMSFSLNDNLAGIISLQTTNIHPTAGTSVLFTDGAGSPTNYSVKFVSPGDTLLDFGSTQGFAAAMSVALG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.