Basic Information | |
---|---|
Taxon OID | 3300031698 Open in IMG/M |
Scaffold ID | Ga0315537_1084399 Open in IMG/M |
Source Dataset Name | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1600 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Massachusetts | |||||||
Coordinates | Lat. (o) | 42.722 | Long. (o) | -70.847 | Alt. (m) | Depth (m) | .7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073189 | Metagenome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315537_10843993 | F073189 | N/A | MLSTIDILSLIEEQKTVDIKQLSKKLEISLGNLKEILIDLANYKLIEYNEKTGKIKLPNWLTKIDREIEELKPATGAIILPRYQEIKIQDLTIGNFTKSDLELKVRLKARLKEIVICDLS |
⦗Top⦘ |