NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310686_119217241

Scaffold Ga0310686_119217241


Overview

Basic Information
Taxon OID3300031708 Open in IMG/M
Scaffold IDGa0310686_119217241 Open in IMG/M
Source Dataset NameFICUS49499 Metagenome Czech Republic combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12183
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.043Long. (o)13.6183Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000687Metagenome / Metatranscriptome937Y
F010410Metagenome / Metatranscriptome304Y

Sequences

Protein IDFamilyRBSSequence
Ga0310686_1192172413F010410AGGAGMPMIKVKPGINLTTFTRTFAPAFAMVALLISAFAADTKDQTSKDQPGKDQPSKDQQAFCKYVTEQAAAQRELLMVPNAVAGVTQPNTGLPMQAVWGVSGSLSGVRKGVLTMDAARKNCELYSATSSAQQDVQYALPTLEKQALQHRLELIQQATESLGALAATTGKMLEAQNMTRPMAFALQTTKIKLDADRADTQSKIVSLYTPPLSGRPVKELIAEKQNREANQQKALDKLSRQNDWDVALSVGAHQQISPWVDSRGAYGEVSISYNLASHAINKHLDQAADAYDDWKKVQEGDVVRNAEILKEQVMNGVSVQDSRLKALQEEQKEIESNLQLVGSADTTAALDFRNQLTTAQLLLKIEIGDASFRFELLREFLRRNY
Ga0310686_1192172415F000687GGAGGMQIQESASAARTIANPGNGHVEEVVRQAHEELRQLLQQRAEVMRRIGTIKQTIAGLANLFGDGVLSDELLELVDRKSSGRQPGFTKACRMVLMDANRALSARDVCDRIQEKAPPMLARHKDPMASVTTVLNRLVAYGEAKAVALENGRRAWQWVADSEPASTRLPVSA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.