NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265314_10115299

Scaffold Ga0265314_10115299


Overview

Basic Information
Taxon OID3300031711 Open in IMG/M
Scaffold IDGa0265314_10115299 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1700
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location
Location NameUSA: Seattle, Washington
CoordinatesLat. (o)47.6516Long. (o)-122.3045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005268Metagenome / Metatranscriptome406Y
F025325Metagenome / Metatranscriptome202Y
F045285Metagenome / Metatranscriptome153Y
F072127Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0265314_101152992F045285GGAGMNHKMSIGMAFIVLFAASVLAQSHDSRIGDDYARAALRAIIYTTQSGITAERISILVDEADVEASTPAEEASLREINRILGIWISRPIADHQACYLALKMNLKARNGATPEACK
Ga0265314_101152993F025325GGAGGMLSDGTQRQKKTWEELVAGASMETDPEKLALTMEEIFAALEERGRTPSPTQNPSGFHEHPTEP
Ga0265314_101152994F005268GAGGVTRSEETEDQKTWRALSEAGLVEIRLDEFAERIADVKRIVIVRLRELLDFDNGIKERESAAYSLGTLKGLELKVLANAPPPTDPSEV
Ga0265314_101152995F072127N/ACPQPQVWRKIDEVTDDEREDCEERLLSMAGSGMDPRQRDQSFWAELNQYLAYTYLRYKQAAGRVQDKMQETER
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.