NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307465_115723

Scaffold Ga0307465_115723


Overview

Basic Information
Taxon OID3300031714 Open in IMG/M
Scaffold IDGa0307465_115723 Open in IMG/M
Source Dataset NameMetatranscriptome of enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen9, Rep 2, Chloramphenicol (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.4149Long. (o)-119.841Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046107Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0307465_1157231F046107N/AENTMYFGKLYYAGIFPFLTNKKEIKPRSNIFKIDSVVSTKLSPDSSFIELLRRDSPFVVIDDDPVLSLCLISTTSKLLVKFGILQYLSNNSSNELLMIGIVYYKKNYTLLVSVIRLCPLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.