NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307474_10088505

Scaffold Ga0307474_10088505


Overview

Basic Information
Taxon OID3300031718 Open in IMG/M
Scaffold IDGa0307474_10088505 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2310
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F019638Metagenome / Metatranscriptome228N
F036729Metagenome / Metatranscriptome169N
F057062Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0307474_100885051F019638N/AVEGGQIQERRLFLFRMTDHGDIILDGVRVDSVQPFAMKEGSGEIRNGMVTFSNVPQHPTVRTRKARVLRSREDRQEFLTSCEKTLGPSFSVFVDGDPRSIRQLDTDTKKQAFLERAPVRPWESRPFQGTAVQQ
Ga0307474_100885053F001473GGAGMESRYQTVGEMYDRLQLMIRQRGDTGFRLAVKDAVLEPRNPFESANKRRPKPALAIVISVFLALAFVFSYFSFHHAA
Ga0307474_100885054F057062N/AMAMLEREDIRSLTSASAGLQNTAAYASPAFPSETRVRDELLSDLVSSVCYWSTVILLALAGAGLLYWRVRHSDSAAAVAGDPFGITTPPWMMLSLPPLGVAASLGHASWCAARGRRAWRMLMTAATLITVMSATTVLEKCLTAL
Ga0307474_100885055F036729GAGGMIHPSESPRHEMTSGEAGVVGAVLGFGLVALALYLAIARYHIRKEQLVEAGLYVFIVTAAIVGPVLRKLVT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.