NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307469_10043660

Scaffold Ga0307469_10043660


Overview

Basic Information
Taxon OID3300031720 Open in IMG/M
Scaffold IDGa0307469_10043660 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2750
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000151Metagenome / Metatranscriptome1897Y
F001423Metagenome / Metatranscriptome698Y
F011193Metagenome / Metatranscriptome294Y

Sequences

Protein IDFamilyRBSSequence
Ga0307469_100436601F001423N/AMKNVYEVLRQKELELSRLEKEVEALRVAAPLLSEDKEATTDSKPT
Ga0307469_100436602F000151GGAGGMEMARNGSNGTGSRNLPGSSDPHVQEVVRAAHEELRQLMRQRADVMKRIGTVKQTIVGLANLFGDAVLSEELLELVDRKSGGRQPGFTKACRMVLMESDCPLGAREVCEKIQQRIPPVLLRHKDPLASVTTVLNRLVEYGEARTVVRDNGRRAWEWVADPADSGFAASRSGFPASSL
Ga0307469_100436604F011193N/ADGKAVVREVKILSQRSGGVVVQGLNGGEDVITAAPQDLKDGEKIKIKGQS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.