NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316577_10347290

Scaffold Ga0316577_10347290


Overview

Basic Information
Taxon OID3300031733 Open in IMG/M
Scaffold IDGa0316577_10347290 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)842
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location
Location NameUSA: Alabama
CoordinatesLat. (o)30.2619Long. (o)-88.2383Alt. (m)Depth (m).05 to .07
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006925Metagenome362Y

Sequences

Protein IDFamilyRBSSequence
Ga0316577_103472901F006925N/AMAGVNVKVLEDFGREAELRRKWVRMWEKLGERILKLPKWMQIIILDDVNTAINNRVATMEMIQN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.