Scaffold Ga0318492_10004097

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0318492_10004097

Scaffold Ga0318492_10004097

Overview

Basic Information
Taxon OID	3300031748 Open in IMG/M
Scaffold ID	Ga0318492_10004097 Open in IMG/M
Source Dataset Name	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5479
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location Name	Puerto Rico: Rio Grande
Coordinates	Lat. (^o)	18.321	Long. (^o)	-65.8172	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072930	Metagenome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0318492_1000409712	F072930	AGGAGG	MSVTFVRSALMVPGKFPQAHEYLEKRVKWLKEKFGVEASLMVLLGGQVGRIATVTE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.