NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315907_10036409

Scaffold Ga0315907_10036409


Overview

Basic Information
Taxon OID3300031758 Open in IMG/M
Scaffold IDGa0315907_10036409 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4405
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F001229Metagenome / Metatranscriptome741Y
F036123Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0315907_100364091F036123N/AMSVEVLPKFDPKAEQPENTVLVRMTRDNFRYDIMGFTFTKEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN
Ga0315907_100364093F001229GAGMNSIVDSVLSMNLDVYRQSEIQDPDTGAIVREWNYYKTVPCHAKGVISNSATTRSSDKQIFSNKYLNDQVIQVRTAEKLTAREKVTNIRDSEGNTIWNEINYPNETPTVFEVMGTTPVTDPFGRVIAYNSSMKRSENQQIGQ
Ga0315907_100364095F000258GGAGGMTANYKLDAMLELRKYLWKELYTRNIFDEEEYWSDNLNENIIPIIPVQQAAEMNQFLSGKKHIVYDKIGLSYEDNWLICCEQVMFTLYSTSVAEINEIRNYMTDEFRRMDESARDINRWTGLSDKFKFHSIWVADISPTAPSEELQGFFSAEVILEVKYSRITDEVGRFL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.