NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315907_10105401

Scaffold Ga0315907_10105401


Overview

Basic Information
Taxon OID3300031758 Open in IMG/M
Scaffold IDGa0315907_10105401 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2414
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008132Metagenome / Metatranscriptome338Y
F015730Metagenome / Metatranscriptome252Y
F029439Metagenome / Metatranscriptome188Y
F084151Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0315907_101054011F029439AGGAMNNIVIDYSHPMASSNTGDSRVFRNSVGNYMSRQAYLELLASKEGVVSHRYLSPNESAWLMSVR
Ga0315907_101054012F084151AGGAMTIEYSIWQGSRLLSVGNTATDIKDIDKVIATLNDSEIAKKIKFSANVMKVEAK
Ga0315907_101054013F008132GAGGMTKWDTIQADISDAYTHLDEEEAYNQMLNDEEDVFGFTKAIQIDHLTDEQLDMISNMFETREAD
Ga0315907_101054015F015730N/AMLSEKTFNKIVWEYQNGGVVSNHPELTTYERKVLLKYLLSLPVKETK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.