NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315907_10148230

Scaffold Ga0315907_10148230


Overview

Basic Information
Taxon OID3300031758 Open in IMG/M
Scaffold IDGa0315907_10148230 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1989
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000808Metagenome / Metatranscriptome882Y
F005092Metagenome / Metatranscriptome412Y
F049499Metagenome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0315907_101482301F005092N/AMDKLEYALRAIKNCDFCGGVGAHYFSNGEDYDFEDCECNPYGLILDGDEVIWDNGLLSEPELAIFGSKEAN
Ga0315907_101482303F000808GAGGMEYTYSLTTSYDGSLVNTLRVSDLLEAVNAWDKCVDFGEAKEYATYNLSDPTGKMYTKTFYRNGEVSIK
Ga0315907_101482304F049499AGGMLTMDYRLVDVLNADQLEVEDLIGLGDEIVKIISIDSIKDGFSLHIENEFGERDIVEIDDSEQFELFILE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.