NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315907_10266312

Scaffold Ga0315907_10266312


Overview

Basic Information
Taxon OID3300031758 Open in IMG/M
Scaffold IDGa0315907_10266312 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1417
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F002060Metagenome / Metatranscriptome597Y
F011938Metagenome / Metatranscriptome285Y

Sequences

Protein IDFamilyRBSSequence
Ga0315907_102663122F002060N/AMSIDYAAIIIALAAAVLSGMGTAIIAGLRENKKEKVRQQEREQDHLKLEIKDLKISLYKLEKELTEWKDKYYNAIQELINVKAELEETLLKLSFIDHKIDELNDLDPEF
Ga0315907_102663123F000671GAGGMEKILCYSCNKTKNKLNAKRSSLLPINLLMCETCINSKLEPRWVIILAGRQNGMDSVKEFVVKKKYVGSDISASELMI
Ga0315907_102663124F011938N/ARVNLVKEYYDIVNVVFIHSMGTYGTVEVLGAFASKVKYEKDGIEYEELMENDEFSIIHEIVFTHIEEEN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.