NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318526_10057151

Scaffold Ga0318526_10057151


Overview

Basic Information
Taxon OID3300031769 Open in IMG/M
Scaffold IDGa0318526_10057151 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1501
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016484Metagenome246Y
F034783Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0318526_100571511F034783N/AVGLVAFLLGARGASAFTTYPVDPVITFDHRADPDRLSDKTSNGQSGETQLRLPEGLRLQFSVPPSNNSTNSPFVTFPSTVFVPSEHR
Ga0318526_100571512F016484GGAGMRVLGLVLSGALTLTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVSRHWGPNGPPGGWCPCVVQGVPTYWVWGPSGGAFDYPFADWRGPTGGWGNP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.