NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318521_10273288

Scaffold Ga0318521_10273288


Overview

Basic Information
Taxon OID3300031770 Open in IMG/M
Scaffold IDGa0318521_10273288 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)991
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F006905Metagenome / Metatranscriptome362Y
F045282Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0318521_102732881F045282GGALTGIHADIDALKGLHGALVRYRHAQRDVTARGEDQLRVARASLEAKAGHCRTQLELNQAELGACQDRAAREAADETAGGTVDCSGYARAVEQCGERLESIRRWQQRIDAEASEFGGIAGR
Ga0318521_102732882F001698AGGAGMAGVINDIEALAEFRAHLMRFNHDLAENFATMQAHWRELGEVWRDDMYRLFGEALEEVTPGIATYLSATEGHEAHLAALIERLGGYLETGTGAGLGVGRPPEARRGQGNGTGRR
Ga0318521_102732883F006905N/APAIDALRAVLREVPEEYPDRNREVNRFLPPLASAIHAIMKEREAEIPYHSRVEHIATGGVAKYPDIVKTSLDELAAEFEGICPRPGGMTT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.