NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315288_11715322

Scaffold Ga0315288_11715322


Overview

Basic Information
Taxon OID3300031772 Open in IMG/M
Scaffold IDGa0315288_11715322 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)505
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5072Long. (o)-110.3564Alt. (m)Depth (m)87
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053131Metagenome141Y
F079798Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0315288_117153221F079798AGGAMSTNSQIAFTPLGKTIVVAATTSAPTGIQAPVYEKFDPQNA
Ga0315288_117153222F053131N/AMEFKWSVNKVTVAEDNLVVKVDLIVTATDGDNTASAAYIRDLVRGDSFIPYNQLTEQQVLDWCFEPIVTTWIDKDKKPQSSTRLIKDEGEAQVVGQIARQLAQKAAEPALPWVKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.