NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315899_10169610

Scaffold Ga0315899_10169610


Overview

Basic Information
Taxon OID3300031784 Open in IMG/M
Scaffold IDGa0315899_10169610 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2217
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053255Metagenome / Metatranscriptome141N
F089883Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0315899_101696102F053255GGAGMFEYFRAMRTTKSHLRYFVYLGNVLDAWGKTGGQQGDPLEMTVFCLIVHHLWGRTLNKHHQDACAVAHADDGCIKAKLSVALEVLSDIKHVLKEEDAGLALNFDRTQNSKTEFLVKGISAADAHAAAQSMVNADPSLEHLLPLLSPASFVVDGYIGLGFPIGTDLFVQHFVKDKCQAIMEDMDKLDNIQDGFIHYQLLRFCQATRLQYLAMNGHVQLANQNVQQHVDHKIANALLKKGTQDAYKTLNQQDRAWVDMQLHESHDEGGFGVSNNRSGCRATTSRTPPHGPAPPPARSCACTRTSCRTSTAPTSRPHPNPHRRPALA
Ga0315899_101696103F089883N/AMHWAPFKALRQRYAGTRFEEQRQLHLPRKHKATVQDSTLRVEMNALEEQPDNAKARDLYWKPLSWLGTIRPTSDNGADAFDPALWATFVSTALGFEVPILSSLPRHHNNPLAKCGCKKLFMDFHGDHTSTCAAHSGATKAHDWMVGVLGPLFRTAGHTVRTQHGVTASAGQRRGDMELRSYLQDAAGRRSLVFDLSMTHDRFG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.