Scaffold Ga0315899_10274918

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315899_10274918

Scaffold Ga0315899_10274918

Overview

Basic Information
Taxon OID	3300031784 Open in IMG/M
Scaffold ID	Ga0315899_10274918 Open in IMG/M
Source Dataset Name	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1673
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Lake Erie, Ohio
Coordinates	Lat. (^o)	41.8268	Long. (^o)	-83.1913	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015719	Metagenome / Metatranscriptome	252	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315899_102749184	F015719	AGGAG	MTMYYSEVDGAEPTVSIQVKDIKYTFTNESLTRLIEEKDAFKLELAQVQRKLTSAQFDVREFFQARYETDHNEIVAEVDDVNNLLVNIGSEELTRSWSATVNISVTVTGLEAPNAEAAEEIIKDSIDVNFTSDGDVWVDDISVESVHPES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.