NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315908_10021670

Scaffold Ga0315908_10021670


Overview

Basic Information
Taxon OID3300031786 Open in IMG/M
Scaffold IDGa0315908_10021670 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4729
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (18.18%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013634Metagenome / Metatranscriptome269Y
F031456Metagenome / Metatranscriptome182Y
F051709Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0315908_1002167011F051709N/AMIPNRERLKIEIAIRPHLQAVQVIKTELHNVNGSIERKWRQLDDFSSSWSFTTWQNWKDAMQGETS
Ga0315908_100216703F031456N/AMALIGSFPASASAVFNLDFLPEFLLIGNSHSDFQPLSSLSVVTSGVQLMSITDQSRITALGKFDSGAILTAPATAGTITSKTAFYLKLATGRINKATTIQGVNARVTAENTFAASTNISNVARRAVEQSINASANATFDNFEALFFSPTNILRAQITFANGYTDEYTPTELQALYAKYHVSDREGELADLLCIDADSGAGLISQVVLFNGSGGTTVVLKSDYVQL
Ga0315908_100216704F013634N/AMPIQIAPLVGAGLGALQQSKIDKALAGEKTYSKPKTIFGKLIGGISGRSAAAEASASVKTAPISEKVMNALQPQAANLDPSYRESFPVTGGVQFGTQAKSRPWLPYAIVAGIVAIFYFMRGKKGRRRRY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.