NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315900_10140625

Scaffold Ga0315900_10140625


Overview

Basic Information
Taxon OID3300031787 Open in IMG/M
Scaffold IDGa0315900_10140625 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2254
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002778Metagenome / Metatranscriptome530N
F019647Metagenome / Metatranscriptome228N

Sequences

Protein IDFamilyRBSSequence
Ga0315900_101406252F019647GAGGMKIVKGVVKYGSGAPREGQYGPSINILVTLEDGSQVRVYGKPGDVIERYKSGQNIQLVDDKGKYKVVEEEMQQAAKQVQNIDVSEKLDLAAMVFEMSAIYSQAYIDIYNKMSEAGIPHENATAATSTIFIQVFQKLR
Ga0315900_101406255F002778AGGAVKEYNAQMMEIKNFCDEVNAWITTAPSAEHLEECDEYLRQLSAYYSRYTVISGMNESIYSQLLMICIRDMAEEEYKRVKHSSTLTDYYVKGKYPKATAIFEQCRAVKQLLLITSDNYRTLLSSFRQERILVGHMTT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.