NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310122_10062343

Scaffold Ga0310122_10062343


Overview

Basic Information
Taxon OID3300031800 Open in IMG/M
Scaffold IDGa0310122_10062343 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1952
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)74.6947Long. (o)-146.6612Alt. (m)Depth (m)3678
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016675Metagenome / Metatranscriptome245Y
F051204Metagenome144N

Sequences

Protein IDFamilyRBSSequence
Ga0310122_100623431F051204GAGMKIKIHSKHVDFKLKAAMHSMCGYAISSLGISNRISKNLNLTIHMGHHSNEGEARVAKDANRYRPRDFKITLDHHRMEKDDYNRTLEDTEWGHRVLRTLAHELVHVKQYIRGELSWRDAGLLWKGVNHNPKNLLHYYDLPY
Ga0310122_100623436F016675AGGAGMRQFEVDYETTVPPWHTGHEKIEAENLDTVREKFCSKHEAARIYKVTEVLYDQRTAINFSESK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.