Scaffold Ga0310121_10007944

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310121_10007944

Scaffold Ga0310121_10007944

Overview

Basic Information
Taxon OID	3300031801 Open in IMG/M
Scaffold ID	Ga0310121_10007944 Open in IMG/M
Source Dataset Name	Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8661
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (53.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location Name	Canada: Western Arctic Ocean
Coordinates	Lat. (^o)	73.0038	Long. (^o)	-140.0007	Alt. (m)		Depth (m)	486
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072856	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310121_100079444	F072856	N/A	MKIDLILQANFWNKSPSILVKLDNKIIKNFDDFVDKQKTNISVDIDAEEGEHQLVIERHNKPVKDTVLEDSKIIKDSTIDIVDVVIDNISIEPLLGKAIFFPQYPEPWLSQQKQIGKEPSIKYDYCRILHHNGEWKLNFTTPIHVWFFQNISVEI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.