Scaffold Ga0316217_10006809

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316217_10006809

Scaffold Ga0316217_10006809

Overview

Basic Information
Taxon OID	3300031813 Open in IMG/M
Scaffold ID	Ga0316217_10006809 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11150
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (90.91%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	46.0411	Long. (^o)	-89.6861	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002946	Metagenome / Metatranscriptome	518	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316217_100068098	F002946	AGGAG	MKKTLLVSLVGLSLGASAVALADKVHDWRDLDKAHHHILESIQELERARAANHYDMAGHGAKAEELLRQAEHELNEAVEAAKAGR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.