Basic Information | |
---|---|
Taxon OID | 3300031813 Open in IMG/M |
Scaffold ID | Ga0316217_10386154 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 524 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 46.0411 | Long. (o) | -89.6861 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031290 | Metagenome / Metatranscriptome | 183 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316217_103861542 | F031290 | AGGA | MARSTFSGPILAGDQRFTQVRNVGYTDLVQTALLDFSVTTPNTANYGGGSGVFVASNNIPNSIGTIYTPQSGSFSNAGPTKASAPTADTSGTIYRGVVFYLPYSCNIT |
⦗Top⦘ |