Scaffold Ga0307478_11440840

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307478_11440840

Scaffold Ga0307478_11440840

Overview

Basic Information
Taxon OID	3300031823 Open in IMG/M
Scaffold ID	Ga0307478_11440840 Open in IMG/M
Source Dataset Name	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	571
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location Name	USA: Indiana
Coordinates	Lat. (^o)	39.0844	Long. (^o)	-86.4705	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072627	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307478_114408401	F072627	N/A	LSNPEHPATSFGQFGVICLIPKQSLQAQHAYSVRIDATWKGKPGTWKWSFSTVSLRGIDASDDRAVASAINIASLVHGTVAYGGMRNSETVSLQLAAGEGSRYKTLSVIIPIAVWRQIAGTAEPGSFKGKIIEVQTTPQVAGGKYVNMRISAVTQLRVVPAR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.