Basic Information | |
---|---|
Taxon OID | 3300031846 Open in IMG/M |
Scaffold ID | Ga0318512_10738142 Open in IMG/M |
Source Dataset Name | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 506 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Puerto Rico: Rio Grande | |||||||
Coordinates | Lat. (o) | 18.321 | Long. (o) | -65.8172 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071099 | Metagenome / Metatranscriptome | 122 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0318512_107381422 | F071099 | N/A | LNTAGITAAFLAAFVTNDSDKLYQSALDGVDSTESALSRVRKRYERMVARIARKYGPRLGIVAAAYGTHNAKVVELKRNRGIALSEDDNLDLTTLDRMLVEARNEIGQRTQHGGSRSPAPEDDTQTVSPFPGRRS |
⦗Top⦘ |