Scaffold Ga0315310_10067030

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315310_10067030

Scaffold Ga0315310_10067030

Overview

Basic Information
Taxon OID	3300031876 Open in IMG/M
Scaffold ID	Ga0315310_10067030 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	1856
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia

Source Dataset Sampling Location
Location Name	Indonesia: South Sulawesi
Coordinates	Lat. (^o)	-2.7726	Long. (^o)	121.4938	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034800	Metagenome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315310_100670302	F034800	GGA	VRIGLDGRILGTLFWAGLVNSVFLIFSLVRIFAAKEVRYGLFDLFNPRFYLANPIFIVLMIIGPVTFISDLMVFSAAGEVSTRTLGLLGLSALNLVGVIFGFAQFVLVNILFRTEQVPSHVWILLALWFILVVSGTLTGTVIMNELAKQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.