NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308404_1004114

Scaffold Ga0308404_1004114


Overview

Basic Information
Taxon OID3300031878 Open in IMG/M
Scaffold IDGa0308404_1004114 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3852
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007404Metagenome / Metatranscriptome351Y
F014738Metagenome / Metatranscriptome260Y
F072382Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0308404_10041146F072382AGGAGGMKTVYHTKDVWFPPFSIKIEPKRGTWFADVYVRYAEDSSLDDKYNAYIGADNFLAETPIPAVDRRDVAKAIESLVFDYGLVDLVICPTREGWGVNITICTELGNQYLHGTGATPADAIRNSNYPPPLRDL
Ga0308404_10041147F014738GGAGMKLDVLLLVSAFALAFVHPDAAQVATTAVLLLLVTRVERERKVRKKKSAPVVR
Ga0308404_10041148F007404GGAGGVDIIEIFQLLAAGHAGLTALDYVWNAVFGAIGAATAYLADKEGVVLLPRYDAEQHSIELGALGRVLVGAGAGTLVGYSGYIPFIAGVVAPTLLPLLVDKITAFVERRRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.