NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315285_10673089

Scaffold Ga0315285_10673089


Overview

Basic Information
Taxon OID3300031885 Open in IMG/M
Scaffold IDGa0315285_10673089 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)671
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.508Long. (o)-110.3268Alt. (m)Depth (m)93
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014504Metagenome / Metatranscriptome262N
F054665Metagenome139N

Sequences

Protein IDFamilyRBSSequence
Ga0315285_106730891F014504N/ADEASYTPDFYSFDDPTAGHAFRMTAYREASEKLLIVLNKTISFLAEHGYSRSKTLWGVAFALGHPLTAGMSMLEAGRELGCTKQAISKIAMDFLDTTGLPPSTSLKSEEARNTYRKTNTNKYGTKRNNGTNPASH
Ga0315285_106730892F054665N/AMEPNEITALTLPVIETEIRAAYAEANALAVTAKGNARAAVLRMADCGQMLMVAKDHVKGNRNEWLASLGIDPDKAAKAIHLARNRDQLELDLWPADMAKLGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.