NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307407_10186551

Scaffold Ga0307407_10186551


Overview

Basic Information
Taxon OID3300031903 Open in IMG/M
Scaffold IDGa0307407_10186551 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1379
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001016Metagenome805Y
F004217Metagenome / Metatranscriptome448Y
F023705Metagenome / Metatranscriptome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0307407_101865511F004217N/AMEREEAELRAANERIAAMAEELRKAELVRDRLEGLGQLMGSYPEGHDMRARLEALHLERALEGVEEDIRDLFDRLQHPRGT
Ga0307407_101865512F001016GGAGGVEPQDPKDVTRDIARDLSSLVKELNALRADANHWLEGPEYAALRLRLESAHAAAEAALVEARRKVRLNEGQ
Ga0307407_101865513F023705AGGAGGLDSREARIGTFVGVIDGAKRPGRGRVGTIEHTYGHPDYLAMDVRFEDGSVELYWYHELERTKVSSLA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.