NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310900_10258742

Scaffold Ga0310900_10258742


Overview

Basic Information
Taxon OID3300031908 Open in IMG/M
Scaffold IDGa0310900_10258742 Open in IMG/M
Source Dataset NameLab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1258
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021411Metagenome / Metatranscriptome219Y
F051558Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
Ga0310900_102587421F051558AGGMPKKADIKASLRGIARALHNFMGTGSEERLPEKLVTLSERLTKSSHKDDPRIEPAIGRVQMSQKLAKSAAELESMIMAELREHPECDSAAVEVTSKEIGWDAVLVRAGTQLNDPCEAMLVEITERLRREFDLSE
Ga0310900_102587423F021411AGGMTTSPIEVREEIDVVSVDPLFIERQRNRYSSRAVAYVVWLNGLAAIALLIGLVHASLRADQVKGFADAMLVFGAGSVAGLTSAFFAYISRTFRLERPHLIGWRQHQVRQSPDHPTTPLPT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.