Scaffold Ga0308175_102306782

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308175_102306782

Scaffold Ga0308175_102306782

Overview

Basic Information
Taxon OID	3300031938 Open in IMG/M
Scaffold ID	Ga0308175_102306782 Open in IMG/M
Source Dataset Name	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	603
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.8864	Long. (^o)	-122.2981	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051255	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308175_1023067822	F051255	GAGG	MYAAAAIATATQQAANEWARSQAARTMVRAAMNSNAVIYRRTWPTLEAIETLGEAEYDPALKFDGFMDSTLDLRDGLSVVEVFAPISDCDALQEFALLRAH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.