NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308420_1011142

Scaffold Ga0308420_1011142


Overview

Basic Information
Taxon OID3300031966 Open in IMG/M
Scaffold IDGa0308420_1011142 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4136
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004791Metagenome / Metatranscriptome423Y
F005302Metagenome / Metatranscriptome405Y
F067304Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0308420_10111423F005302AGGAGGMSHSGVIEGLFAGNFAVEISTDATTWTAVSNATVKVDDVELNRPSGEAFVGGSSDHATITVGKREPVELTLTFLYNEATGSATNTIFDRFQSATPTLGVRWSPRGLVGSARAYGTSNDGGTSFGLGVITNVTLSTLDPSDAEPYVAMVTVRTPSLRQYALGSSPTNLNPAP
Ga0308420_10111424F004791AGGAGGMTTPAEIYDIDTIRVDRSALTIREAASVLNNELTAPVVARLVRKAIGAQADRFPLRSLKAVYERVLPQIFEPDEAVQSRVAGLTPAVGGITLGEYHEFLDASERKIAFPEVAKTLLIKAYGENILNEPYAAAALLLKKIFDSIGDEGNG
Ga0308420_10111425F067304N/AMPPLCAQRRKVLRDALQRQMVKRVRRAVVDVPAQHQFGIRSGQRREVEQT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.