NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315914_1056042

Scaffold Ga0315914_1056042


Overview

Basic Information
Taxon OID3300031967 Open in IMG/M
Scaffold IDGa0315914_1056042 Open in IMG/M
Source Dataset NameMedicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)846
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.06Long. (o)-118.44Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012754Metagenome277Y

Sequences

Protein IDFamilyRBSSequence
Ga0315914_10560421F012754AGTAGMLAERKIEQAAIEAARDEKLQSIGIDASDDYFLEKLAEVRQLAGSVQKQVVEEAAELLEQIPEASVAVTSVVASESASIASVSEAPVQVTQTSNLPLIIPSPVSLSNDSDIDDVPIGQRMRRLSKPSPQPHQTTPQLPLQAEQSSAAAECTEDPEDPPASDLPQCDSPSNLFSLERHLGGEITKTPEKATKSVAQKIELVNQPEPVAETAVPESVQVIDSEQTITVTESEPNQQQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.