NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315278_10033779

Scaffold Ga0315278_10033779


Overview

Basic Information
Taxon OID3300031997 Open in IMG/M
Scaffold IDGa0315278_10033779 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4940
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5094Long. (o)-110.5094Alt. (m)Depth (m)88
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036462Metagenome / Metatranscriptome170Y
F042051Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0315278_100337793F042051AGGAGMTTFGEVKWEDNAPGEGKNSKDLWLRLESGPNEVRLLTQPFQYLMHKYKKEGDPGFGQKVYCSAIHGSCPLCDAGDKAKPRWLLGVIDRRTGTYKILDISWAVYQQIKTYAQNTKSWGDPTKYDLNIVVNKNGGATGYYTVQPVPKEPLSATDQQIKDNVDFDDLKRRVTPPNPEQVQKRIDKINGANSPSLVVAPTSSTSKPKAKPNGKPQVTPVSMDDDDESFPAYTG
Ga0315278_100337798F036462N/ARNAMTQQVRLGDFVGTQLEENFLDFDLTEIQEVLLALREESAIDLSHAEMLQQKSLRGADILSEYLGKIVKTIGYLEAKINSTKNKVALEYVSLDGSRITMEMRRFAGEASPEVEELLIKLAKAKGSKSVLEKKYDIIIKSHHYHKDIAAGMRKSVLGYNIPNNEKVPQGWE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.