NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315274_10040471

Scaffold Ga0315274_10040471


Overview

Basic Information
Taxon OID3300031999 Open in IMG/M
Scaffold IDGa0315274_10040471 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6358
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5119Long. (o)-110.3577Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000324Metagenome / Metatranscriptome1299Y
F001538Metagenome / Metatranscriptome674Y
F003265Metagenome / Metatranscriptome496Y

Sequences

Protein IDFamilyRBSSequence
Ga0315274_100404715F000324N/AMINKIPPKFTVTYDGASVNVYHANKGEGLPKHEHFYAHLTMCHSGSCLVTKEGKSLVMTKDTQPVNLVANEWHELEALEDGTVFVNIFAESKH
Ga0315274_100404716F003265AGGMFWAQAKSPCIVTDFYALSWINEPTMRHMELSRWLTTNGDNCSSADLAGIWNKLAEWAGVADSAELRSKVLYYYARARAREDK
Ga0315274_100404717F001538GGAGGMIETIRLFPTVQASGYPDKHDLAQAKLEKTQDTNKTLEVSKQKQTELQDIGFEIYCKKVVQERLRMEIFTNRTLDIYV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.