Scaffold Ga0315296_10000295

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315296_10000295

Scaffold Ga0315296_10000295

Overview

Basic Information
Taxon OID	3300032020 Open in IMG/M
Scaffold ID	Ga0315296_10000295 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	45895
Total Scaffold Genes	55 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	38 (69.09%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.5367	Long. (^o)	-110.4246	Alt. (m)		Depth (m)	13
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052324	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315296_1000029520	F052324	GAGG	LNILQTVLQTAVRNPARAPAMGASFIFGVIMAVSILLITVGVFYVLWKLGGLLDAMKEKTEAAKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.